SEQUENTIAL
PROPHET REV2
ULTIMATE PATCHES
AS SEEN ON SONICSTATE

THE #1 BEST-SELLING
PROPHET REV2 PATCH COLLECTION

200 HIGH-QUALITY ULTIMATE PATCHES
RETRO > MODERN • ACOUSTIC > HI‑TEK

Compatible with all Rev2 models!
Fast 'n' Easy USB Install Guide (PC/Mac)
+ Printable Patch List Included. View PDF

 VINTAGE  FUTURE  PADS  GUITARS  PIANOS  STRINGS  PLUCKS  LEADS  SFX
 VOICES  WHISTLES  SHOTS  BASS  HORNS  FLUTES  ORGANS  DRUMS  LO‑FI
 HOUSE  SYNTHWAVE  WORLD+LATIN  ORCHESTRA  TECHNO  RAVE  TRAP+RAP
 CLASSIC ROCK+POP  DISCO  AMBIENT  TRANCE  DUBSTEP  R&B  RETROCADE


$19.99  COVID RELIEF SALE (Reg. $29.99)
PROPHET REV2 ULTIMATE PATCHES
VOLUME 1: 100 PATCHES
INSTANT DIGITAL DOWNLOAD


$19.99  COVID RELIEF SALE (Reg. $29.99)
PROPHET REV2 ULTIMATE PATCHES
VOLUME 2: 100 PATCHES
INSTANT DIGITAL DOWNLOAD


$29.99  COVID RELIEF SALE (Reg. $49.99)
VALUE BUNDLE
PROPHET REV2 ULTIMATE PATCHES
VOL. 1 + 2: 200 PATCHES
INSTANT DIGITAL DOWNLOAD

Your download link is provided during the end of Paypal checkout.
Don't have Paypal?
Click here for other payment options.

▲ Get CASH-BACK when you purchase multiple Value Bundles! Details here

Your digital download includes:
  • Ultimate Patches in Standard Prophet Rev2 .syx Format (Keyboard / Module)
  • Fast 'n' Easy USB Install Manual (PDF)
  • Printable Patch List (PDF)
  • Support Contact Info

Easy-Install Requirements:

Questions? We're here to help! Contact us HERE and we'll reply to you within 24 hours.

Copyright 2021 Ultimate Patches. All sales final. Digital delivery.


ASM HYDRASYNTH
ULTIMATE PATCHES
AS SEEN ON FUTUREMUSIC

THE #1 BEST-SELLING
HYDRASYNTH PATCH COLLECTION

300 HIGH-QUALITY ULTIMATE PATCHES
RETRO > MODERN • ACOUSTIC > HI‑TEK

Compatible with all Hydrasynth models!
Fast 'n' Easy USB Install Guide (PC/Mac)
+ Printable Patch List Included. View PDF

VINTAGE FUTURE PADS GUITARS PIANOS STRINGS PLUCKS LEADS SFX
VOICES WHISTLES SHOTS BASS HORNS FLUTES ORGANS DRUMS LO‑FI
HOUSE SYNTHWAVE WORLD+LATIN ORCHESTRA TECHNO RAVE TRAP+RAP
CLASSIC ROCK+POP DISCO AMBIENT TRANCE DUBSTEP R&B RETROCADE



$19.99  COVID RELIEF SALE (Reg. $29.99)
HYDRASYNTH ULTIMATE PATCHES
VOLUME 1: 100 PATCHES
INSTANT DIGITAL DOWNLOAD


$19.99  COVID RELIEF SALE (Reg. $29.99)
HYDRASYNTH ULTIMATE PATCHES
VOLUME 2: 100 PATCHES
INSTANT DIGITAL DOWNLOAD


$19.99  COVID RELIEF SALE (Reg. $29.99)
HYDRASYNTH ULTIMATE PATCHES
VOLUME 3: 100 PATCHES
INSTANT DIGITAL DOWNLOAD


$34.99  COVID RELIEF SALE (Reg. $59.99)
VALUE BUNDLE
HYDRASYNTH ULTIMATE PATCHES
VOL. 1, 2, 3: 300 PATCHES
INSTANT DIGITAL DOWNLOAD

Your download link is provided during the end of Paypal checkout.
Don't have Paypal?
Click here for other payment options.

▲ Get CASH-BACK when you purchase multiple Value Bundles! Details here

Your digital download includes:
  • Ultimate Patches in Standard ASM Hydrasynth Format (Keyboard / Module)
  • Fast 'n' Easy USB Install Manual (PDF)
  • Printable Patch List (PDF)
  • Support Contact Info

Easy-Install Requirements:

Questions? We're here to help! Contact us HERE and we'll reply to you within 24 hours.

Copyright 2021 Ultimate Patches. All sales final. Digital delivery.


ARTURIA MICROFREAK
ULTIMATE PATCHES
AS SEEN ON FUTUREMUSIC

THE #1 BEST-SELLING
MICROFREAK PATCH COLLECTION

333 HIGH-QUALITY ULTIMATE PATCHES
RETRO > MODERN • ACOUSTIC > HI‑TEK

Compatible with all MicroFreak models!
Fast 'n' Easy USB Install Guide (PC/Mac)
+ Printable Patch List Included. View PDF

VINTAGE FUTURE PADS GUITARS PIANOS STRINGS PLUCKS LEADS SFX
VOICES WHISTLES SHOTS BASS HORNS FLUTES ORGANS DRUMS LO‑FI
HOUSE SYNTHWAVE WORLD+LATIN ORCHESTRA TECHNO RAVE TRAP+RAP
CLASSIC ROCK+POP DISCO AMBIENT TRANCE DUBSTEP R&B RETROCADE



$19.99  COVID RELIEF SALE (Reg. $29.99)
MICROFREAK ULTIMATE PATCHES
VOLUME 1: 111 PATCHES
INSTANT DIGITAL DOWNLOAD


$19.99  COVID RELIEF SALE (Reg. $29.99)
MICROFREAK ULTIMATE PATCHES
VOLUME 2: 111 PATCHES
INSTANT DIGITAL DOWNLOAD


$19.99  COVID RELIEF SALE (Reg. $29.99)
MICROFREAK ULTIMATE PATCHES
VOLUME 3: 111 PATCHES
INSTANT DIGITAL DOWNLOAD


$34.99  COVID RELIEF SALE (Reg. $59.99)
VALUE BUNDLE
MICROFREAK ULTIMATE PATCHES
VOL. 1, 2, 3: 333 PATCHES
INSTANT DIGITAL DOWNLOAD

Your download link is provided during the end of Paypal checkout.
Don't have Paypal?
Click here for other payment options.

▲ Get CASH-BACK when you purchase multiple Value Bundles! Details here

Your digital download includes:
  • Ultimate Patches in Standard Arturia MicroFreak Format
  • Fast 'n' Easy USB Install Manual (PDF)
  • Printable Patch List (PDF)
  • Support Contact Info

Easy-Install Requirements:

Questions? We're here to help! Contact us HERE and we'll reply to you within 24 hours.

Copyright 2021 Ultimate Patches. All sales final. Digital delivery.


ROLAND SE-02
ULTIMATE PATCHES
AS SEEN ON FUTUREMUSIC

THE #1 BEST-SELLING
SE-02 PATCH COLLECTION

333 HIGH-QUALITY ULTIMATE PATCHES
RETRO > MODERN • ACOUSTIC > HI‑TEK

Fast 'n' Easy USB Install Guide (PC/Mac)
+ Printable Patch List Included. View PDF

VINTAGE FUTURE PADS GUITARS PIANOS STRINGS PLUCKS LEADS SFX
VOICES WHISTLES SHOTS BASS HORNS FLUTES ORGANS DRUMS LO‑FI
HOUSE SYNTHWAVE WORLD+LATIN ORCHESTRA TECHNO RAVE TRAP+RAP
CLASSIC ROCK+POP DISCO AMBIENT TRANCE DUBSTEP R&B RETROCADE



$19.99  COVID RELIEF SALE (Reg. $29.99)
SE-02 ULTIMATE PATCHES
VOLUME 1: 111 PATCHES
INSTANT DIGITAL DOWNLOAD


$19.99  COVID RELIEF SALE (Reg. $29.99)
SE-02 ULTIMATE PATCHES
VOLUME 2: 111 PATCHES
INSTANT DIGITAL DOWNLOAD


$19.99  COVID RELIEF SALE (Reg. $29.99)
SE-02 ULTIMATE PATCHES
VOLUME 3: 111 PATCHES
INSTANT DIGITAL DOWNLOAD


$34.99  COVID RELIEF SALE (Reg. $59.99)
VALUE BUNDLE
SE-02 ULTIMATE PATCHES
VOL. 1, 2, 3: 333 PATCHES
INSTANT DIGITAL DOWNLOAD

Your download link is provided during the end of Paypal checkout.
Don't have Paypal?
Click here for other payment options.

▲ Get CASH-BACK when you purchase multiple Value Bundles! Details here

Your digital download includes:
  • Ultimate Patches in Standard Roland SE-02 Format
  • Fast 'n' Easy USB Install Manual (PDF)
  • Printable Patch List (PDF)
  • Support Contact Info

Easy-Install Requirements:
  • An SE-02
  • PC Windows 7 SP1+ or Mac OS X 10.10+

Questions? We're here to help! Contact us HERE and we'll reply to you within 24 hours.

Copyright 2021 Ultimate Patches. All sales final. Digital delivery.


ROLAND JU-06A
ULTIMATE PATCHES
AS SEEN ON SONICSTATE

THE #1 BEST-SELLING
JU-06A PATCH COLLECTION

444 HIGH-QUALITY ULTIMATE PATCHES
(333 NEW FOR 2020 + 111 FROM THE 2018 JU-06 MASTER COLLECTION)

RETRO > MODERN • ACOUSTIC > HI‑TEK

Fast 'n' Easy USB Install Guide (PC/Mac)
+ Printable Patch List Included. View PDF

VINTAGE FUTURE PADS GUITARS PIANOS STRINGS PLUCKS LEADS SFX
VOICES WHISTLES SHOTS BASS HORNS FLUTES ORGANS DRUMS LO‑FI
HOUSE SYNTHWAVE WORLD+LATIN ORCHESTRA TECHNO RAVE TRAP+RAP
CLASSIC ROCK+POP DISCO AMBIENT TRANCE DUBSTEP R&B RETROCADE



$19.99  COVID RELIEF SALE (Reg. $29.99)
JU-06A ULTIMATE PATCHES
VOLUME 1: 148 PATCHES
INSTANT DIGITAL DOWNLOAD


$19.99  COVID RELIEF SALE (Reg. $29.99)
JU-06A ULTIMATE PATCHES
VOLUME 2: 148 PATCHES
INSTANT DIGITAL DOWNLOAD


$19.99  COVID RELIEF SALE (Reg. $29.99)
JU-06A ULTIMATE PATCHES
VOLUME 3: 148 PATCHES
INSTANT DIGITAL DOWNLOAD


$34.99  COVID RELIEF SALE (Reg. $59.99)
VALUE BUNDLE
JU-06A ULTIMATE PATCHES
VOL. 1, 2, 3: 444 PATCHES
INSTANT DIGITAL DOWNLOAD

Your download link is provided during the end of Paypal checkout.
Don't have Paypal?
Click here for other payment options.

▲ Get CASH-BACK when you purchase multiple Value Bundles! Details here

Your digital download includes:
  • Ultimate Patches in Standard Roland JU-06A Format
  • Fast 'n' Easy USB Install Manual (PDF)
  • Printable Patch List (PDF)
  • Support Contact Info

Easy-Install Requirements:
  • A JU-06A
  • PC Windows 7 SP1+ or Mac OS X 10.12+

Questions? We're here to help! Contact us HERE and we'll reply to you within 24 hours.

Copyright 2021 Ultimate Patches. All sales final. Digital delivery.


KORG MINILOGUE XD
ULTIMATE PATCHES
AS SEEN IN KORG NEWS

THE #1 BEST-SELLING
MINILOGUE XD PATCH COLLECTION

333 HIGH-QUALITY ULTIMATE PATCHES
RETRO > MODERN • ACOUSTIC > HI‑TEK

Compatible with all Minilogue XD models!
Fast 'n' Easy USB Install Guide (PC/Mac)
+ Printable Patch List Included. View PDF

VINTAGE FUTURE PADS GUITARS PIANOS STRINGS PLUCKS LEADS SFX
VOICES WHISTLES SHOTS BASS HORNS FLUTES ORGANS DRUMS LO‑FI
HOUSE SYNTHWAVE WORLD+LATIN ORCHESTRA TECHNO RAVE TRAP+RAP
CLASSIC ROCK+POP DISCO AMBIENT TRANCE DUBSTEP R&B RETROCADE



$19.99  COVID RELIEF SALE (Reg. $29.99)
MINILOGUE XD ULTIMATE PATCHES
VOLUME 1: 111 PATCHES
INSTANT DIGITAL DOWNLOAD


$19.99  COVID RELIEF SALE (Reg. $29.99)
MINILOGUE XD ULTIMATE PATCHES
VOLUME 2: 111 PATCHES
INSTANT DIGITAL DOWNLOAD


$19.99  COVID RELIEF SALE (Reg. $29.99)
MINILOGUE XD ULTIMATE PATCHES
VOLUME 3: 111 PATCHES
INSTANT DIGITAL DOWNLOAD


$34.99  COVID RELIEF SALE (Reg. $59.99)
VALUE BUNDLE
MINILOGUE XD ULTIMATE PATCHES
VOL. 1, 2, 3: 333 PATCHES
INSTANT DIGITAL DOWNLOAD

Your download link is provided during the end of Paypal checkout.
Don't have Paypal?
Click here for other payment options.

▲ Get CASH-BACK when you purchase multiple Value Bundles! Details here

Your digital download includes:
  • Ultimate Patches in Standard Korg Minilogue XD Librarian Format
  • Fast 'n' Easy USB Install Manual (PDF)
  • Printable Patch List (PDF)
  • Support Contact Info

Easy-Install Requirements:

Questions? We're here to help! Contact us HERE and we'll reply to you within 24 hours.

Copyright 2021 Ultimate Patches. All sales final. Digital delivery.


BEHRINGER DEEPMIND
ULTIMATE PATCHES
AS SEEN ON SONICSTATE

THE #1 BEST-SELLING
DEEPMIND PATCH COLLECTION

333 HIGH-QUALITY ULTIMATE PATCHES
RETRO > MODERN • ACOUSTIC > HI‑TEK

Compatible with all DeepMind models (6 / 12 / 12D)
Fast 'n' Easy USB Install Guide (PC/Mac)
+ Printable Patch List Included. View PDF

VINTAGE FUTURE PADS GUITARS PIANOS STRINGS PLUCKS LEADS SFX
VOICES WHISTLES SHOTS BASS HORNS FLUTES ORGANS DRUMS LO‑FI
HOUSE SYNTHWAVE WORLD+LATIN ORCHESTRA TECHNO RAVE TRAP+RAP
CLASSIC ROCK+POP DISCO AMBIENT TRANCE DUBSTEP R&B RETROCADE



$19.99  COVID RELIEF SALE (Reg. $29.99)
DEEPMIND ULTIMATE PATCHES
VOLUME 1: 111 PATCHES
INSTANT DIGITAL DOWNLOAD


$19.99  COVID RELIEF SALE (Reg. $29.99)
DEEPMIND ULTIMATE PATCHES
VOLUME 2: 111 PATCHES
INSTANT DIGITAL DOWNLOAD


$19.99  COVID RELIEF SALE (Reg. $29.99)
DEEPMIND ULTIMATE PATCHES
VOLUME 3: 111 PATCHES
INSTANT DIGITAL DOWNLOAD


$34.99  COVID RELIEF SALE (Reg. $59.99)
VALUE BUNDLE
DEEPMIND ULTIMATE PATCHES
VOL. 1, 2, 3: 333 PATCHES
INSTANT DIGITAL DOWNLOAD

Your download link is provided during the end of Paypal checkout.
Don't have Paypal?
Click here for other payment options.

▲ Get CASH-BACK when you purchase multiple Value Bundles! Details here

Your digital download includes:
  • Ultimate Patches in Standard DeepMind + .syx Formats (6 / 12 / 12D)
  • Fast 'n' Easy USB Install Manual (PDF)
  • Printable Patch List (PDF)
  • Support Contact Info

Easy-Install Requirements:

Questions? We're here to help! Contact us HERE and we'll reply to you within 24 hours.

Copyright 2021 Ultimate Patches. All sales final. Digital delivery.


ARTURIA MINIBRUTE
ULTIMATE PATCHES
AS SEEN IN ARTURIA NEWS

THE #1 BEST-SELLING
MINIBRUTE PATCH COLLECTION

80 HIGH-QUALITY ULTIMATE PATCHES
DELUXE PDF PATCH BOOKLET (NOT FOR MINIBRUTE 2 / 2S)
RETRO > MODERN • ACOUSTIC > HI‑TEK

Fast 'n' Easy Patch Sheets - Free Sample Here

RETRO & MODERN PADS / LEADS / ARPS / BASSES / DRUMS / FX

VINTAGECINEMATICTRAPSYNTHWAVEHOUSEPOPDUBSTEPCHILL
HIP–HOPAMBIENTRETROCADER&BJAZZTRANCEREGGAEFUTURE


$14.99  COVID RELIEF SALE (Reg. $24.99)
MINIBRUTE ULTIMATE PATCHES
VOLUME 1: 40 PATCHES
INSTANT DIGITAL DOWNLOAD


$14.99  COVID RELIEF SALE (Reg. $24.99)
MINIBRUTE ULTIMATE PATCHES
VOLUME 2: 40 PATCHES
INSTANT DIGITAL DOWNLOAD


$19.99  COVID RELIEF SALE (Reg. $34.99)
VALUE BUNDLE
MINIBRUTE ULTIMATE PATCHES
VOL. 1 + 2: 80 PATCHES
INSTANT DIGITAL DOWNLOAD

Your download link is provided during the end of Paypal checkout.
Don't have Paypal?
Click here for other payment options.

▲ Get CASH-BACK when you purchase multiple Value Bundles! Details here

Your digital download includes:
  • Deluxe Minibrute Patch Booklet (PDF)
  • Printable Patch List (PDF)
  • Support Contact Info

Questions? We're here to help! Contact us HERE and we'll reply to you within 24 hours.

Copyright 2021 Ultimate Patches. All sales final. Digital delivery.


ROLAND D-05 / D-50 
ULTIMATE PATCHES
AS SEEN ON SONICSTATE

THE #1 BEST-SELLING
D-50 / D-05 PATCH COLLECTION

256 HIGH-QUALITY ULTIMATE PATCHES
RETRO > MODERN • ACOUSTIC > HI‑TEK

Compatible with: D-05 Boutique, Roland Cloud D-50 / VST, V-Synth XT, V-Synth VC-1, D-50/550, variOS VC-1

Fast & Easy USB Install Guide (PC/Mac)
+ Printable Patch List Included. View PDF

FUTURISTICEVOLVING PADSGUITARSPIANOSSTRINGSPLUCKSLO–FI VOICESWHISTLESBASSSFXHORNSORGANSLEADSFLUTESDRUMS
VINTAGEMODERNCINEMATICORCHESTRALSYNTHWAVEDUBSTEPPOP CLASSIC ROCKCHIPTUNER&BTRAP/RAPTRANCEJAZZLATINHOUSE


$19.99  COVID RELIEF SALE (Reg. $29.99)
ROLAND D-05 / D-50
ULTIMATE PATCHES
VOLUME 1+2: 128 PATCHES
INSTANT DIGITAL DOWNLOAD


$19.99  COVID RELIEF SALE (Reg. $29.99)
ROLAND D-05 / D-50
ULTIMATE PATCHES
VOLUME 3+4: 128 PATCHES
INSTANT DIGITAL DOWNLOAD


$34.99  COVID RELIEF SALE (Reg. $59.99)
VALUE BUNDLE
ROLAND D-05 / D-50
ULTIMATE PATCHES
VOL. 1, 2, 3, 4: 256 PATCHES
INSTANT DIGITAL DOWNLOAD

▲ Get CASH-BACK when you purchase multiple Value Bundles! Details here

Your digital download includes:
  • Ultimate Patches in Roland D-05 format,
    and .syx format for Roland Cloud / VST,
    D-50/D-550, VC-1, V-Synth XT, etc
  • Easy-Install Manual (PDF)
  • Printable Patch List (PDF)
  • Support Contact Info
Easy-Install Requirements:
  • If D-05: PC Windows 7 SP1 or Mac OSX 10.9
  • If Roland Cloud: Roland Cloud D-50 Subscription, PC Windows 7 SP1 or Mac OSX 10.7
  • If V-Synth+VC1, V-Synth XT, variOS+VC-1, D-50/D-550: PC or Mac + MIDI interface + a MIDI dump utility

Questions? We're here to help! Contact us HERE and we'll reply to you within 24 hours.

Copyright 2021 Ultimate Patches. All sales final. Digital delivery.


NOVATION BASS STATION II
& AFX STATION
ULTIMATE PATCHES
AS SEEN ON MATRIXSYNTH

THE #1 BEST-SELLING
BASS STATION 2 + AFX STATION
PATCH COLLECTION

OVER 300 HIGH-QUALITY ULTIMATE PATCHES
RETRO > MODERN • ACOUSTIC > HI‑TEK

Compatible with Bass Station 2 and AFX Station!
Fast 'n' Easy USB Install Guide (PC/Mac)
+ Printable Patch List Included. View PDF

VINTAGE FUTURE PADS GUITARS PIANOS STRINGS PLUCKS LEADS SFX
VOICES WHISTLES SHOTS BASS HORNS FLUTES ORGANS DRUMS LO‑FI
HOUSE SYNTHWAVE WORLD+LATIN ORCHESTRA TECHNO RAVE TRAP+RAP
CLASSIC ROCK+POP DISCO AMBIENT TRANCE DUBSTEP R&B RETROCADE



$19.99  COVID RELIEF SALE (Reg. $29.99)
BASS STATION II / AFX STATION ULTIMATE PATCHES
VOLUME 1: 150+ PATCHES
INSTANT DIGITAL DOWNLOAD


$19.99  COVID RELIEF SALE (Reg. $29.99)
BASS STATION II / AFX STATION ULTIMATE PATCHES
VOLUME 2: 150+ PATCHES
INSTANT DIGITAL DOWNLOAD


$34.99  COVID RELIEF SALE (Reg. $59.99)
VALUE BUNDLE
BASS STATION II / AFX STATION ULTIMATE PATCHES
VOL. 1 + 2: OVER 300 PATCHES
INSTANT DIGITAL DOWNLOAD

Your download link is provided during the end of Paypal checkout.
Don't have Paypal?
Click here for other payment options.

▲ Get CASH-BACK when you purchase multiple Value Bundles! Details here

Your digital download includes:
  • Ultimate Patches in Standard Novation Bass Station II
    & AFX Station Format
  • Fast 'n' Easy USB Install Manual (PDF)
  • Printable Patch List (PDF)
  • Support Contact Info

Easy-Install Requirements:
  • Bass Station II or AFX Station
  • PC Windows 7/8/10 or Mac OS X 10.8+
  • The free Novation Components program

Questions? We're here to help! Contact us HERE and we'll reply to you within 24 hours.

Copyright 2021 Ultimate Patches. All sales final. Digital delivery.


IK MULTIMEDIA UNO SYNTH
ULTIMATE PATCHES
AS SEEN ON IK MULTIMEDIA.COM

THE #1 BEST-SELLING
UNO SYNTH PATCH COLLECTION

222 HIGH-QUALITY ULTIMATE PATCHES
RETRO > MODERN • ACOUSTIC > HI‑TEK

Fast 'n' Easy USB Install Guide (PC/Mac)
+ Printable Patch List Included. View PDF

FUTURISTICEVOLVING PADSCARRIBEAPIANOSTRINGSPLUCKSLO–FI VOICESARPS303BASSSFXHORNSFLUTESORGANDRUMSLEADS
VINTAGEMODERNCINEMATICORCHESTRALSYNTHWAVEDUBSTEPPOP CLASSIC ROCKCHIPTUNER&BTRAP/RAPTRANCEJAZZLATINHOUSE


$19.99  COVID RELIEF SALE (Reg. $29.99)
UNO SYNTH ULTIMATE PATCHES
VOLUME 1: 111 PATCHES
INSTANT DIGITAL DOWNLOAD


$19.99  COVID RELIEF SALE (Reg. $29.99)
UNO SYNTH ULTIMATE PATCHES
VOLUME 2: 111 PATCHES
INSTANT DIGITAL DOWNLOAD


$29.99  COVID RELIEF SALE (Reg. $49.99)
VALUE BUNDLE
UNO SYNTH ULTIMATE PATCHES
VOL. 1 + 2: 222 PATCHES
INSTANT DIGITAL DOWNLOAD

Your download link is provided during the end of Paypal checkout.
Don't have Paypal?
Click here for other payment options.

▲ Get CASH-BACK when you purchase multiple Value Bundles! Details here

Your digital download includes:
  • Ultimate Patches in Standard Uno Synth Format
  • Fast 'n' Easy USB Install Manual (PDF)
  • Printable Patch List (PDF)
  • Support Contact Info

Easy-Install Requirements:

Questions? We're here to help! Contact us HERE and we'll reply to you within 24 hours.

Copyright 2021 Ultimate Patches. All sales final. Digital delivery.


KORG MINILOGUE
ULTIMATE PATCHES
AS SEEN ON KORG.CO.UK NEWS

THE #1 BEST-SELLING
MINILOGUE PATCH COLLECTION

400 HIGH-QUALITY ULTIMATE PATCHES
RETRO > MODERN • ACOUSTIC > HI‑TEK

Fast 'n' Easy USB Install Guide (PC/Mac)
+ Printable Patch List Included. View PDF

For Minilogue only. For our newer Minilogue XD patches, click here.


FUTURISTICEVOLVING PADSCARRIBEPIANOSSTRINGSPLUCKSLO–FI VOICESARPSHARMONICABASSSFXHORNSORGANSDRUMSLEADS
VINTAGEMODERNCINEMATICORCHESTRALSYNTHWAVEDUBSTEPPOP CLASSIC ROCKCHIPTUNER&BTRAP/RAPTRANCEJAZZLATINHOUSE




$24.99  COVID RELIEF SALE (Reg. $34.99)
MINILOGUE ULTIMATE PATCHES
VOLUME 1: 200 PATCHES
INSTANT DIGITAL DOWNLOAD


$24.99  COVID RELIEF SALE (Reg. $34.99)
MINILOGUE ULTIMATE PATCHES
VOLUME 2: 200 PATCHES
INSTANT DIGITAL DOWNLOAD


$34.99  COVID RELIEF SALE (Reg. $59.99)
VALUE BUNDLE
MINILOGUE ULTIMATE PATCHES
VOL. 1 + 2: 400 PATCHES
INSTANT DIGITAL DOWNLOAD

Your download link is provided during the end of Paypal checkout.
Don't have Paypal?
Click here for other payment options.

▲ Get CASH-BACK when you purchase multiple Value Bundles! Details here

Your digital download includes:
  • Ultimate Patches in Korg Minilogue Librarian Format
  • Fast 'n' Easy USB Install Manual (PDF)
  • Printable Patch List (PDF)
  • Support Contact Info

Easy-Install Requirements:

Questions? We're here to help! Contact us HERE and we'll reply to you within 24 hours.

Copyright 2021 Ultimate Patches. All sales final. Digital delivery.


KORG MONOLOGUE
ULTIMATE PATCHES
AS SEEN ON KORG UK NEWS

THE #1 BEST-SELLING
MONOLOGUE PATCH COLLECTION

300 HIGH-QUALITY ULTIMATE PATCHES
RETRO > MODERN • ACOUSTIC > HI‑TEK

Fast 'n' Easy USB Install Guide (PC/Mac)
+ Printable Patch List Included. View PDF

FUTURISTICEVOLVING PADSGUITARSPIANOSSTRINGSPLUCKSLO–FI VOICESHARMONICABASSSFXHORNSFLUTESORGANPERCLEADS
VINTAGEMODERNCINEMATICORCHESTRALSYNTHWAVEDUBSTEPPOP CLASSIC ROCKCHIPTUNER&BTRAP/RAPTRANCEJAZZLATINHOUSE


$19.99  COVID RELIEF SALE (Reg. $29.99)
MONOLOGUE ULTIMATE PATCHES
VOLUME 1: 100 PATCHES
INSTANT DIGITAL DOWNLOAD


$19.99  COVID RELIEF SALE (Reg. $29.99)
MONOLOGUE ULTIMATE PATCHES
VOLUME 2: 100 PATCHES
INSTANT DIGITAL DOWNLOAD


$19.99  COVID RELIEF SALE (Reg. $29.99)
MONOLOGUE ULTIMATE PATCHES
VOLUME 3: 100 PATCHES
INSTANT DIGITAL DOWNLOAD


$34.99  COVID RELIEF SALE (Reg. $59.99)
VALUE BUNDLE
MONOLOGUE ULTIMATE PATCHES
VOL. 1, 2, 3: 300 PATCHES
INSTANT DIGITAL DOWNLOAD

Your download link is provided during the end of Paypal checkout.
Don't have Paypal?
Click here for other payment options.

▲ Get CASH-BACK when you purchase multiple Value Bundles! Details here

Your digital download includes:
  • Ultimate Patches in Korg Monologue Librarian Format
  • Fast 'n' Easy USB Install Manual (PDF)
  • Printable Patch List (PDF)
  • Support Contact Info

Easy-Install Requirements:

Questions? We're here to help! Contact us HERE and we'll reply to you within 24 hours.

Copyright 2021 Ultimate Patches. All sales final. Digital delivery.


ROLAND JU-06
ULTIMATE PATCHES
AS SEEN IN KEYBOARD
& ELECTRONIC MUSICIAN

THE #1 BEST-SELLING
JU-06 PATCH COLLECTION

300 HIGH-QUALITY ULTIMATE PATCHES
- COMPATIBLE WITH JU-06 & JU-06A
RETRO > MODERN • ACOUSTIC > HI‑TEK

PLUS, FREE BONUS WITH VALUE BUNDLE PURCHASE:
THE 128 JUNO-106 1984 FACTORY PATCHES! (JU-06 ONLY)


Fast 'n' Easy USB Install Guide (PC/Mac)
+ Printable Patch List Included. View PDF 1 2

FUTURISTICEVOLVING PADSCARRIBEAPIANOSTRINGSPLUCKSLO–FI VOICESARPS303BASSSFXHORNSFLUTESORGANDRUMSLEADS
VINTAGEMODERNCINEMATICORCHESTRALSYNTHWAVEDUBSTEPPOP CLASSIC ROCKCHIPTUNER&BTRAP/RAPTRANCEJAZZLATINHOUSE



$24.99  COVID RELIEF SALE (Reg. $34.99)
JU-06 ULTIMATE PATCHES
VOLUME 1-3: 150 PATCHES
INSTANT DIGITAL DOWNLOAD


$24.99  COVID RELIEF SALE (Reg. $34.99)
JU-06 ULTIMATE PATCHES
VOLUME 4-6: 150 PATCHES
INSTANT DIGITAL DOWNLOAD


$34.99  COVID RELIEF SALE (Reg. $59.99)
VALUE BUNDLE
JU-06 ULTIMATE PATCHES
VOL. 1-6: 300 PATCHES
PLUS FREE BONUS: THE 128 JUNO-106 1984 FACTORY PATCHES!
INSTANT DIGITAL DOWNLOAD

Your download link is provided during the end of Paypal checkout.
Don't have Paypal?
Click here for other payment options.

▲ Get CASH-BACK when you purchase multiple Value Bundles! Details here

Your digital download includes:
  • Ultimate Patches in Standard Roland JU-06 and JU-06A Formats
  • Fast 'n' Easy USB Install Manual (PDF)
  • Printable Patch List (PDF)
  • Support Contact Info

Easy-Install Requirements:
  • JU-06 or JU-06A
  • PC Windows 7 SP1+, Mac OS X 10.12+

Questions? We're here to help! Contact us HERE and we'll reply to you within 24 hours.

Copyright 2021 Ultimate Patches. All sales final. Digital delivery.


ROLAND SH-01A
ULTIMATE PATCHES
AS SEEN ON SYNTH ANATOMY

THE #1 BEST-SELLING
SH-01A PATCH COLLECTION

320 HIGH-QUALITY ULTIMATE PATCHES
RETRO > MODERN • ACOUSTIC > HI‑TEK

WITH HUNDREDS OF POLY SH-101 PATCHES!

Fast 'n' Easy USB Install Guide (PC/Mac)
+ Printable Patch List Included. View PDF

VINTAGE FUTURE PADS GUITARS PIANOS STRINGS PLUCKS LEADS SFX
VOICES WHISTLES SHOTS BASS HORNS FLUTES ORGANS DRUMS LO‑FI
HOUSE SYNTHWAVE WORLD+LATIN ORCHESTRA TECHNO RAVE TRAP+RAP
CLASSIC ROCK+POP DISCO AMBIENT TRANCE DUBSTEP R&B RETROCADE




$24.99  COVID RELIEF SALE (Reg. $34.99)
SH-01A ULTIMATE PATCHES
VOLUME 1-3: 160 PATCHES
INSTANT DIGITAL DOWNLOAD


$24.99  COVID RELIEF SALE (Reg. $34.99)
SH-01A ULTIMATE PATCHES
VOLUME 4-6: 160 PATCHES
INSTANT DIGITAL DOWNLOAD


$34.99  COVID RELIEF SALE (Reg. $59.99)
VALUE BUNDLE
SH-01A ULTIMATE PATCHES
VOL. 1-6: 320 PATCHES
INSTANT DIGITAL DOWNLOAD

Your download link is provided during the end of Paypal checkout.
Don't have Paypal?
Click here for other payment options.

▲ Get CASH-BACK when you purchase multiple Value Bundles! Details here

Your digital download includes:
  • Ultimate Patches in Standard Roland SH-01A Format
  • Fast 'n' Easy USB Install Manual (PDF)
  • Printable Patch List (PDF)
  • Support Contact Info

Easy-Install Requirements:
  • An SH-01A
  • PC Windows 7 SP1+, Mac OS X 10.10+

Questions? We're here to help! Contact us HERE and we'll reply to you within 24 hours.

Copyright 2021 Ultimate Patches. All sales final. Digital delivery.


ROLAND JP-08
ULTIMATE PATCHES
AS SEEN ON FUTUREMUSIC

THE #1 BEST-SELLING
JP-08 PATCH COLLECTION

300+ HIGH-QUALITY ULTIMATE PATCHES
RETRO > MODERN • ACOUSTIC > HI‑TEK

PLUS, FREE BONUS WITH VALUE BUNDLE PURCHASE:
THE 64 JP-08 1981 FACTORY PATCHES!


Fast 'n' Easy USB Install Guide (PC/Mac)
+ Printable Patch List Included. View PDF

FUTURISTICEVOLVING PADSGUITARSPIANOSSTRINGSPLUCKSLO–FI VOICESHARMONICABASSSFXHORNSFLUTEORGANSDRUMLEADS
VINTAGEMODERNCINEMATICORCHESTRALSYNTHWAVEDUBSTEPPOP CLASSIC ROCKCHIPTUNER&BTRAP/RAPTRANCEJAZZLATINHOUSE



$24.99  COVID RELIEF SALE (Reg. $34.99)
JP-08 ULTIMATE PATCHES
VOLUME 1: 150 PATCHES
INSTANT DIGITAL DOWNLOAD


$24.99  COVID RELIEF SALE (Reg. $34.99)
JP-08 ULTIMATE PATCHES
VOLUME 2: 150 PATCHES
INSTANT DIGITAL DOWNLOAD


$34.99  COVID RELIEF SALE (Reg. $59.99)
VALUE BUNDLE
JP-08 ULTIMATE PATCHES
VOL. 1+2: 300 PATCHES

PLUS FREE BONUS: THE 1981 ORIGINAL 64 JUPITER-8 FACTORY PATCHES
INSTANT DIGITAL DOWNLOAD

Your download link is provided during the end of Paypal checkout.
Don't have Paypal?
Click here for other payment options.

▲ Get CASH-BACK when you purchase multiple Value Bundles! Details here

Your digital download includes:
  • Ultimate Patches in Standard Roland JP-08 Format
  • Fast 'n' Easy USB Install Manual (PDF)
  • Printable Patch List (PDF)
  • Support Contact Info

Easy-Install Requirements:
  • A JP-08
  • PC Windows 7 SP1+, Mac OS X 10.9+

Questions? We're here to help! Contact us HERE and we'll reply to you within 24 hours.

Copyright 2021 Ultimate Patches. All sales final. Digital delivery.


ROLAND JD-Xi
ULTIMATE PATCHES
AS SEEN ON SONICSTATE

THE #1 BEST-SELLING
JD-XI PATCH COLLECTION

720 HIGH-QUALITY ULTIMATE PATCHES
RETRO > MODERN • ACOUSTIC > HI‑TEK

Fast 'n' Easy USB Install Guide (PC/Mac)
+ Printable Patch List Included. View PDF

VINTAGEMODERNCINEMATICORCHESTRALSYNTHWAVEDUBSTEPPOP CLASSIC ROCKCHIPTUNER&BTRAP/RAPTRANCEJAZZLATINHOUSE


$19.99  COVID RELIEF SALE (Reg. $29.99)
JD-XI ULTIMATE PATCHES
VOLUME 1: 180 PATCHES
INSTANT DIGITAL DOWNLOAD


$19.99  COVID RELIEF SALE (Reg. $29.99)
JD-XI ULTIMATE PATCHES
VOLUME 2: 180 PATCHES
INSTANT DIGITAL DOWNLOAD


$19.99  COVID RELIEF SALE (Reg. $29.99)
JD-XI ULTIMATE PATCHES
VOLUME 3: 180 PATCHES
INSTANT DIGITAL DOWNLOAD


$19.99  COVID RELIEF SALE (Reg. $29.99)
JD-XI ULTIMATE PATCHES
VOLUME 4: 180 PATCHES
INSTANT DIGITAL DOWNLOAD


$39.99  COVID RELIEF SALE (Reg. $59.99)
VALUE BUNDLE
JD-XI ULTIMATE PATCHES
VOL. 1-4: 720 PATCHES
INSTANT DIGITAL DOWNLOAD

Your download link is provided during the end of Paypal checkout.
Don't have Paypal?
Click here for other payment options.

▲ Get CASH-BACK when you purchase multiple Value Bundles! Details here

Your digital download includes:
  • Ultimate Patches in Standard Roland JD-Xi Format
  • Fast 'n' Easy USB Install Manual (PDF)
  • Printable Patch List (PDF)
  • Support Contact Info

Easy-Install Requirements:
  • A JD-Xi
  • PC Windows 7/8/10 or Mac OS X 10.7+

Questions? We're here to help! Contact us HERE and we'll reply to you within 24 hours.

Copyright 2021 Ultimate Patches. All sales final. Digital delivery.


News

NOVATION MININOVA / ULTRANOVA PATCHES ANNOUNCEMENT
NEWS UPDATE
•  August 10, 2021

These popular synths from Novation are getting the Ultimate Patches treatment, with many patches using our Vintage Voice Character programming for vintage analog character and depth. Prepare for a feast of both vintage analog and futuristic digital sounds! Both synths use the same sound engine so the patches will work on either synth. Coming October 29 2021!

PROPHET REV2 PATCHES RELEASED!
NEW RELEASE
•  July 28, 2021

They're here! 200 Ultimate Patches for Sequential Prophet Rev2 - including our Vintage Voice Character programming on many patches for realistic vintage vibe (similar to Vintage Mode on Sequential Prophet-5). Plus, we include Vintage Voice Character templates for you to be able to easily create your own ultra-vintage sounding patches!

PROPHET REV2 PATCHES INCOMING!
NEWS UPDATE
•  June 9, 2021

Our Sequential Prophet Rev2 Ultimate Patches are being worked on as we speak. Coming July 2021!

ROLAND CLOUD D-50 ULTIMATE PATCHES
New Release
•  May 4, 2021

Our popular D-05 / D-50 Ultimate Patches are now compatible with and available for Roland Cloud D-50. Enjoy!

REV2 / SUBSEQUENT 37 RELEASES
NEWS UPDATE
•  April 8, 2021

Our Sequential Rev2 and Moog Subsequent 37 Ultimate Patches releases are on hold due to – yes you guessed it – Covid-related supplier delays and shortages! Matter of fact, we couldn't even find a Hydrasynth Desktop to make patches with, and had to scour the used market to finally get one! We'll let you know in a few days what our updated near-future scheduled releases are.

HYDRASYNTH ULTIMATE PATCHES
New Release
•  March 27, 2021

New for 2021, and a fresh start to spring - with 300 brand new Ultimate Patches for the ASM Hydrasynth! Compatible with the keyboard and desktop versions, and with aftertouch and mod wheel expressiveness on over 90% of the patches, we spent a lot of time crafting these and the results are truly ear candy. Enjoy!

HYDRASYNTH INCOMING!
NEWS UPDATE
• December 28, 2020

Our Hydrasynth Ultimate Patches are coming Saturday March 27. Apologies for moving the release date again, but covid logistics is mostly to blame (plus, we've moved to a new and improved studio including major ongoing renovations). Don't worry though, as were putting in the time we need to make the patches spectacular! Get ready...

COVID-19 RELIEF DISCOUNTS EXTENDED
NEWS UPDATE
•  October 12, 2020

We're extending our COVID relief discounts to help all our customers suffering due to the pandemic. Also, we've added ASM Hydrasynth, Pro-800, and Roland JX-03 to the roster of patches coming soon, and have had to bump our Moog Subsequent-37 and Prophet REV2 patches to 2021 due to COVID-19 logistics snafus. Stay safe, stay cool, and enjoy the summer!

ARTURIA MICROFREAK ULTIMATE PATCHES
New Release
•  June 27, 2020

The MicroFreak is one of the best analog/digital hybrid synths and has greatly inspired us to create some amazing sounds - 333 brand new patches, released today. Enjoy!

MULTI-BUY CASH-BACK NOW AVAILABLE
NEWS UPDATE
•  April 20, 2020

Due to popular demand, we now offer cash back when you order multiple Value Bundles on the same day! Click Here for details.

ROLAND SE-02 ULTIMATE PATCHES
New Release
•  April 16, 2020

They're here! 333 SE-02 Ultimate Patches that smash the limits of your expectations. Enjoy!

COVID RELIEF DISCOUNTS FOR A LIMITED TIME
News Update
•  April 4, 2020

Due to the financial hardships many of our customers are facing, we are giving special discounts on all Value Bundles for a limited time. Enjoy!

JU-06 MASTER COLLECTION FOR JU-06A
New Release
•  March 5, 2020

Our best-selling 2018 JU-06 Master Collection (300+ Patches) is now compatible with JU-06A as well, bringing the total JU-06A Ultimate Patches available to over 635!

ROLAND JU-06A ULTIMATE PATCHES
New Release
•  January 11, 2020

This one gets the full treatment - 444 patches: 333 new patches plus 111 patches taken from our 2018 JU-06 Master Collection. Enjoy!

MINILOGUE XD ULTIMATE PATCHES
New Release
•  November 3, 2019

This is our best collection yet - bristling with analog, digital, and analog/digital hybrids, these 333 patches cover a lot of territory. Enjoy!

MINILOGUE XD PATCHES
News Update
•  October 28 2019

We've decided to delay the the release by a couple weeks to work overtime to make this our best patch collection yet! Coming November 3, 2019.

DEEPMIND (12 / 12D / 6) ULTIMATE PATCHES
New Release
•  August 30 2019

It's here! Thanks for your patience - we think you'll agree it was worth the wait, as we've put in a lot of time and passion to tweak 333 patches to perfection. Enjoy!

ARTURIA MINIBRUTE ULTIMATE PATCHES
New Release
•  July 7 2019

New for 2019! When the MiniBrute was released, most demo videos showcased its harsh and aggressive side. Nice, but it also has the capability to deliver thick & warm old-school 70s/80s analog sounds. We focused on that plus modern sounds.

Oh, and how did we get oscillator sync (Patch 80) on a one-oscillator synth?

Secret!
wink

NEW NEWS about our NEW NEWS SECTION
News Update •  June 18 2019

Our site redesign and new news section (this page) is now live. We'll be updating it on an ongoing basis with new product announcements, sales, product updates and more!

ROLAND D-05 ULTIMATE PATCHES
New Release
•  June 16 2019

Today marks the day that D-05 owners can get a serious refresh and get their hands on our latest collection of Ultimate Patches: 256 to be exact, focused strongly on modern as well as classic vintage sounds. Enjoy!

NOVATION BASS STATION II ULTIMATE PATCHES
New Release
•  February 4 2019

Can you teach an old dog new tricks? Yes, yes you can. We've squeezed a lot of goodness out of this synth and we're happy to share all 300 results with you guys! Thanks to Novation for the recent Bass Station II firmware - we've added those spices into many of the patches. Enjoy!

UNO SYNTH ULTIMATE PATCHES
New Release
•  January 24 2019

The little synth that could. What can a $199 tiny synth do? A hell of a lot. This is a true VCO synth with a really nice filter set which gives us lots to work with. Not to mention all the hidden features we took advantage of while creating these goodies. Enjoy!

KORG MONOLOGUE ULTIMATE PATCHES
New Release
•  November 1 2018

The last synth designed by Tatsuya while at Korg. Crazy good value for a synth of this caliber. Don't believe those who say "it's a beginner's analog synth". This is no slouch. Listen to what we've coaxed out of it and you'll agree. Enjoy!

ROLAND SH-01A ULTIMATE PATCHES
New Release
•  July 17, 2018

The thing that blows our mind about this synth, is the 4 voice polyphony and the stellar unison mode. You can't get that out of the original, and the results are astounding. We've shared with you our inspired sounds of this cutie beauty (we've got the electric-blue one). Enjoy!

ROLAND JU-06 ULTIMATE PATCHES
New Release
•  April 2, 2018

We released a couple smaller patch sets last year for the JU-06 (64 Ultimate Bass, 64 Ultimate Poly+Lead), which we've retired. Why? Because we've created this MUCH bigger patch set (over 300!). We've included a few of the best patches from the original 2017 sets, so you get the best of both worlds. Enjoy!

ROLAND JP-08 ULTIMATE PATCHES
New Release
•  December 1, 2017

Let us take you on a trip to Jupiter. The crossmod on this synth makes it very very flexible, and the "dual" layer mode is killer. Check out our video patch demos to see what she's capable of. It's not just for vintage sounds, although we've got plenty of those in the patchset. Enjoy!

KORG MINILOGUE ULTIMATE PATCHES, VOL 2
New Release
•  August 7, 2017

Thank you to all who have purchased Volume 1. Your enthusiasm and requests got us back in the studio to make a fresh new collection - Volume 2, now available. We went deeper into areas of the synth that we discovered while making Volume 1, making this a unique patchset that goes hand in hand with Volume 1. Enjoy!

ROLAND JD-XI ULTIMATE PATCHES
New Release
•  June 26, 2017

720 patches created over 2 years of programming, this stunning collection covers a wide range of modern, vintage, and future sounds and genres. Lots of high quality patches in here - digital, analog as well as a few free drum kits! Enjoy!

ROLAND JU-06 ULTIMATE PATCHES
New Release
•  May 5 2017

2 Volumes - Ultimate Bass and Ultimate Poly + Lead, 64 patches per volume provides a definite upgrade for the JU-06. (UPDATE APRIL 2, 2018: This release has been retired, replaced by the bigger JU-06 Vol. 1-6 Master Collection.)

KORG MINILOGUE ULTIMATE PATCHES, VOL 1
New Release
•  March 2, 2017

Our first patchset released into the wild! Many months in the making, this has been a labour of love and passion. She's so good at polys AND arps AND (non-resonant) basses. And FX. And leads. We enjoyed every minute of it. We think you will too. Enjoy!

Welcome to ULTIMATE PATCHES

Who are we? Synth nerds, music lovers, tech addicts. We love vintage synths, modern synths. Pretty much nearly all synths. And we get inspired by a ton of music, vintage and current. After years of patch programming for various artists & music label releases, we decided it was time to offer Ultimate Patches to the masses in order to share the fruits of all we have learned. We love what we do and promise to live up to our name - giving you ULTIMATE patch sets that are tweaked to perfection. Don't just take our word for it though, check out our coverage in Keyboard Magazine, Electronic Musician, Korg UK news, SonicState, etc...and find out for yourself by trying out our high quality presets at a great price!

FAQ

Is there a difference between "Synth Patches", "Synth Presets" and "Synth Sounds"?
"Presets" used to only mean "the factory sounds included in a synth", but has evolved to also be another word for non-factory patches such as Ultimate Patches. When we say "Presets", "Patches" or "Sounds" on this site, what we mean is fresh new Patches from Ultimate Patches.

What are the patch installation requirements?
Installation is straightforward (we include an Easy-Install manual) via usb cable from your PC/Mac to your synth (some older synths have no USB port and require install via the MIDI IN port). You can download any of our patch install manuals (pdf) and read them before purchase –there's a link to the pdf manual on every product page. You can also contact us with any questions pre or post purchase via our Contact page.

I'm having trouble getting the patches loaded into my synth. What should I do?
We've tested the patches to ensure smooth installation, so failed installs are usually caused by overlooked / misread instructions or out-of-date synth firmware. Here are the usual fixes:

  • Update your synth to the firmware version mentioned in the install manual.
  • Update the synth's patch librarian (if there is one) to the version number mentioned in install manual.
  • Take a second (and third!) look thru the install manual in case you missed or misread a step.
  • Try a different usb cable. as some are manufactured poorly or are outdated, causing random issues.
  • If you've done all of those and still are having trouble, please contact support via our Contact page and we'll help get you up and running.

What preset pack is Ultimate Patches releasing next?
All future and past releases are listed HERE.

How can I contact Ultimate Patches with my questions, comments, if I lost my patches, or for anything else?
We're here to help and value your business and enjoyment! Please contact us via our Contact page, and we'll help you within 12-24 hours.

What is included in the purchase?

  • Your set of Ultimate Patches
  • Easy-Install manual (PDF)
  • Printable patch list (PDF)
  • Support Contact Information

Do you include patch sheets for your patches?
We provide a patchlist (list of patch names) with your download. However, printable patch sheets that show the values of each patch parameter are not usually included.

How to I receive the patches once purchased?
During the end steps of Paypal checkout, you will be provided with a link to your download. If you missed the link for whatever reason, just contact us via our Contact page and we'll email your patches to you within 12-24 hours.

Are the sequences from your Youtube patch demo video included?
Most of the performances in our demo videos are recorded live and played by hand, not sequence. That said, sometimes sequences are included.

How do I know Ultimate Patches is a reputable company?
We've been seen in Electronic Musician, FutureMusic Magazine, Keyboard Magazine, Sonic State, MatrixSynth and others. We've been providing quality patches via ultimatepatches.com and our Ebay store for years. We respond to support requests quickly and effectively, and have a 100% positive feedback rating on Ebay. We're here to answer your inquiries and typically reply within 12-24 hours, so don't hesitate to contact us at any time.

I found someone selling/sharing Ultimate Patches outside of ultimatepatches.com / Ultimate Patches Ebay store.
Ultimate Patches are only sold on ultimatepatches.com and our Ultimate Patches store on Ebay sites. Report it to us, please. We will not let the pirate know it was you who reported it to us. It's much appreciated, as selling patches is how we put bread on our table and it's how we continue to exist!

Why do you turn off commenting on some of your Youtube videos?
Our customers are usually very happy with Ultimate Patches and comment favorably in posts - but there are occasional bad actors who spam or post misinformation to try to damage our reputation. We don't want to help give them a voice, because we've worked hard to get where we are!

Who programs the patches?
None other than Scott-John Dougan!

What are Ultimate Patches Cash-Back Rewards?
When you buy 2 or more Value Bundles on the same day, you can get Cash-Back Rewards. Here's the details.

I lost my patches in a catastrophic computer crash, etc. Help!
No problem! Just drop a line via our Contact page and we'll email your patches to you nearly always on the same day.

RELEASE SCHEDULE

What patches are coming next?
We're always looking to the future — a theme you can hear throughout many of our patches. Here's our recent and upcoming releases. If you'd like to suggest a patch, synth, or artists you like, drop us a quick line via our Contact page - we value your feedback and love to hear your thoughts and suggestions!

2021
• Sequential Prophet Rev2 ( July 2021 )
• Roland Cloud D-50 ( April 2021 )
• ASM Hydrasynth ( March 2021 )

• Novation MiniNova & UltraNova ( Coming October 29 2021 )
• Unannounced ( Coming December 2021 )

2020
• Arturia MicroFreak ( June 2020 )
• Roland SE-02 ( April 2020 )
• Roland JU-06A ( Jan 2020 )

2019
• Korg Minilogue XD ( Nov 2019 )
• Behringer Deepmind 6/12/12D ( Aug 2019 )
• Arturia Minibrute ( July 2019 )
• Roland D-05 ( June 2019 )
• Novation Bass Station II ( Feb 2019 )
• IK Multimedia UNO Synth ( Jan 2019 )

2018
• Korg Monologue Volume 1-3 ( Nov 2018 )
• Roland SH-01a Volume 1-6 ( July 2018 )
• Roland JU-06 Volume 1-6 ( April 2018 )

2017
• Korg Minilogue Volume 1 ( March 2017 )
• Roland JU-06 Bass, Poly, Lead ( May 2017 )
• Roland JD-Xi Volume 1-4 ( June 2017 )
• Korg Minilogue Volume II ( Aug 2017 )
• Roland JP-08 Volume 1+2 ( Dec 2017 )


Updated August 10, 2021.

Contact

Questions, requesting a Cash-Back Reward, lost your patches and need a replacement, paying via Western Union, need help with installation, etc?

We're here to help and value your business. Drop us a line via the form below and we'll help you within 24 hours.

  • Join us on Facebook:   Facebook




  • 1601 2nd Avenue North
    Great Falls, Montana 59401
    USA

    214 - 19138 26th Ave, Ste #N362880
    Surrey, BC, V3Z 3V7
    Canada

ABOUT ULTIMATE PATCHES
synth sounds / synth presets

Seen in Electronic Musician, Keyboard Magazine, FutureMusic Magazine, Korg.uk news, IK Multimedia news and others, Ultimate Patches has gained the reputation of being a top choice of synth enthusiasts worldwide, offering generous collections of high quality, royalty-free synth sounds (aka synth presets / synth patches) to help our customer's productions take off to the next level!

Our synth patches have been used worldwide in chart hits including pop, trap, ballads, retrocade, house, ambient, hip-hop, latin, reggae, dubstep, synthwave, rock, disco and more. If you want cutting-edge synth sounds or authentic vintage synth presets, join the thousands of happy customers who are enjoying Ultimate Patches. With decades of professional patch creation experience, our synth sounds are authentic and powerful go-to collections of vintage, modern, and futuristic synth patches.

We love our customers — without your there would be no Ultimate Patches. That's why we continue to provide ultimate customer service & support to you, responding to your inquiries usually within a few hours, 365 days a year.

We've got lots of new synth patches coming, so check out our News section for new releases, teasers, sales and more!


CORONAVIRUS RELIEF
DISCOUNTS

▶️ ENJOY LIMITED-TIME SAVINGS!

To help our customers during these challenging times, we're giving coronavirus relief discounts on all products including our Value Bundles. These discounted prices are shown on all product pages.

Limited time offer. Combinable with other discounts / offers. Enjoy!

ULTIMATE PATCHES
CASH-BACK REWARDS

▶️ Save BIG when you buy multiple Value Bundles!

Buy more than one Value Bundle on the same day, and receive:

    • $10 Cash Back when you purchase 2 Value Bundles
    • $20 Cash Back when you purchase 3 Value Bundles
    • $30 Cash Back when you purchase 4 or more Value Bundles

To receive your cash back reward:

    • Make your multiple Value Bundle purchases on this site.
      (all must be purchased on the same day).
    • Contact us and tell us which Value Bundles you've purchased
      and that you are requesting your Cash-Back Reward.
    • We'll send the money to your PayPal account within 24 hours.
Cash-Back Rewards Offer is available now but is subject to change in the future.

Payment Options

▶️ Don't have a Paypal account?
Click on our Buy Now buttons to pay via Credit Card, Visa Debit or Paypal. After you click on our Paypal button, choose "checkout as Guest" - it will be processed by Paypal but does NOT require a Paypal account.

▶️ Paypal not available in your country?
You can pay online or in person worldwide with Western Union.

▶️ Don't have a credit card or Visa debit?
You can pay online or in person worldwide with Western Union.

Visit Western Union Online

It's easy to send with Western Union; visit www.westernunion.com and follow the instructions to send money. When you fill out the form on their site to send money to us, enter our receipent info:
➤ Recipient: Scott John Dougan
➤ Recipient's Country: Canada

Contact us with the money transfer number (MTCN) issued to you by Western Union after sending, and we'll email your patches to you within 24-48 hours.

Questions? Feel free to contact us if you have any questions. We're here to help!


Privacy

Ultimate Privacy

Unlike a lot of companies these days, we don't secretly collect and sell your personal info to other companies. Any personal info you provide is used only by Ultimate Patches to communicate with you, when sending you news & promotions, to analyze our web traffic, and when getting your orders to you.

Our site is protected using Digicert SSL Encryption for your security and privacy.